DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42780 and CG42564

DIOPT Version :9

Sequence 1:NP_001284979.1 Gene:CG42780 / 10178796 FlyBaseID:FBgn0261848 Length:254 Species:Drosophila melanogaster
Sequence 2:NP_649651.2 Gene:CG42564 / 40788 FlyBaseID:FBgn0260766 Length:500 Species:Drosophila melanogaster


Alignment Length:237 Identity:67/237 - (28%)
Similarity:112/237 - (47%) Gaps:15/237 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 NFCRQDLCTKGTTHIACQNVNGSFGSSCPKDATVIKLNLGDKNALIKAHNLVRQKWASGKAKIKW 85
            ::|...||.|...|:|| |.:......|..||.:|.::...:..|::..|.:|...|.|......
  Fly    54 DYCDPSLCHKELKHVAC-NASIELHDKCSLDAELIVISPKVERFLLRRFNELRDSVAKGGFNGLS 117

  Fly    86 TACKMAKMEWNKDLEKLAILNAKTCLMGHDECHNTEKFRLSGQNLFAMGFSHARITKTKMNMTLS 150
            .|.:|..::||.:|..||..|.:.|::.||||.||:..:.:||.:...|.      |.|:.....
  Fly   118 PASRMGTLKWNPELAYLAEFNVRDCVLRHDECRNTKFTQNAGQTVGYRGI------KGKLPELED 176

  Fly   151 MLFEMAVQKWAGEEKDITAEDLKK---TTPNPPEVIGHLTVLINEKSNAVGCGLVAYNL-GEIRR 211
            :|.:: :..|..|:...:..::.|   .....|:.  :...::.|.:.:|||.:|..:. |.|:.
  Fly   177 ILRDI-IGVWLREKSRTSMVNIMKYVEQESQSPKY--NFLQIVLENAESVGCAIVQQSRHGWIQT 238

  Fly   212 YNLACNYAYTNVIGERVYEECAKAGIECAKGIDQKYPPLCAK 253
            : .||||.:..|:|..|||...||...|..|.:.||..|||:
  Fly   239 F-FACNYGHAPVVGSPVYEPGKKAAESCKTGANPKYAHLCAE 279

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42780NP_001284979.1 SCP_euk 62..219 CDD:240180 40/160 (25%)
CG42564NP_649651.2 SCP_euk 95..245 CDD:240180 40/159 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45440577
Domainoid 1 1.000 41 1.000 Domainoid score I8510
eggNOG 1 0.900 - - E1_COG2340
Homologene 1 1.000 - - H77274
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D102857at33392
OrthoFinder 1 1.000 - - FOG0000453
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10334
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
87.850

Return to query results.
Submit another query.