DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42780 and crisp1.7

DIOPT Version :9

Sequence 1:NP_001284979.1 Gene:CG42780 / 10178796 FlyBaseID:FBgn0261848 Length:254 Species:Drosophila melanogaster
Sequence 2:NP_989314.1 Gene:crisp1.7 / 394939 XenbaseID:XB-GENE-5779195 Length:244 Species:Xenopus tropicalis


Alignment Length:221 Identity:52/221 - (23%)
Similarity:79/221 - (35%) Gaps:56/221 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    44 FGSSCPKDATVIKLNLGDKNALIKAHNLVRQKWASGKAKIKWTACKMAKMEWNKDLEKLAILNAK 108
            |.|...:.||       ::..::..||..|:       ....||..|.||.|:.:.|..|...|.
 Frog    23 FSSLSTRYAT-------NRQKIVDIHNAYRR-------SANPTASNMLKMSWSIEAENNAKNWAT 73

  Fly   109 TCLMGHDECHNTEKFRLS-GQNLFAMGFSHARITKTKMNMTLSMLFEMAVQKWAGE----EKDIT 168
            ||...|.:....:...:: |:|||...:..:              :|..:|....|    |..:.
 Frog    74 TCNQYHSQPAARQIANITCGENLFMSSYPAS--------------WEEVIQSLHSEYDNFEYGVG 124

  Fly   169 AEDLKKTTPNPPEVIGHLTVLINEKSNAVGCGLVAY-----NLGEIRRYNLACNYAYTNVIGERV 228
            |:.:..       ||||.|.::..||..:||    |     |.|...:|...|.|.......:|:
 Frog   125 AKAVGL-------VIGHYTQVMWYKSYRIGC----YCTECPNDGVRLKYYYVCQYYPAGNYADRI 178

  Fly   229 ---YEECAKAGIECAKGIDQKYPPLC 251
               |    |:|..||...|.....||
 Frog   179 NYPY----KSGPSCADCPDACDNGLC 200

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42780NP_001284979.1 SCP_euk 62..219 CDD:240180 38/166 (23%)
crisp1.7NP_989314.1 CAP_CRISP 32..171 CDD:349402 40/177 (23%)
Crisp 188..243 CDD:369954 5/13 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.