DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42780 and glipr1b

DIOPT Version :9

Sequence 1:NP_001284979.1 Gene:CG42780 / 10178796 FlyBaseID:FBgn0261848 Length:254 Species:Drosophila melanogaster
Sequence 2:XP_005159058.1 Gene:glipr1b / 393547 ZFINID:ZDB-GENE-040426-1459 Length:255 Species:Danio rerio


Alignment Length:193 Identity:47/193 - (24%)
Similarity:73/193 - (37%) Gaps:39/193 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    66 IKAHNLVRQKWASGKAKIKWTACKMAKME-WNKDLEKLAILNAKTCLMGHDECHNTEKFRLSGQN 129
            :||||..|.:.:...|..:....::..|: |:|:|.|.|...|:.|               .|.:
Zfish    38 VKAHNTHRARVSPPAAGARSMVRQVFGMQSWDKELAKGARDRARHC---------------KGSH 87

  Fly   130 LFAMG-FSHARITKTKMNMTLSMLF-----EMAVQKWAGEEKDITAEDLKKTTPNPPEVIGHLTV 188
            ..::| |.|........|:.|...|     |.||.:|:.|    .|..:|..  |...:.||...
Zfish    88 YPSLGHFGHPLFGWMGENIWLGSPFSAFSVENAVHRWSKE----GAYSVKNN--NCSRLCGHYAQ 146

  Fly   189 LINEKSNAVGCGLVAYNLGEIRRYN-------LACNYAYT-NVIGERVYEE--CAKAGIECAK 241
            |:...|..:||.:...:.| |..::       ..|||..| .|.|...|..  |:..|.|..:
Zfish   147 LMWSTSFKMGCAVNVCSKG-IENFSTHPESTIFVCNYGDTGQVHGVTPYMAMGCSGCGSEICR 208

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42780NP_001284979.1 SCP_euk 62..219 CDD:240180 39/166 (23%)
glipr1bXP_005159058.1 SCP 32..185 CDD:294090 40/168 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.