DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42780 and CG8072

DIOPT Version :9

Sequence 1:NP_001284979.1 Gene:CG42780 / 10178796 FlyBaseID:FBgn0261848 Length:254 Species:Drosophila melanogaster
Sequence 2:NP_648384.1 Gene:CG8072 / 39181 FlyBaseID:FBgn0036070 Length:247 Species:Drosophila melanogaster


Alignment Length:256 Identity:67/256 - (26%)
Similarity:109/256 - (42%) Gaps:26/256 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSVFTFNIFVLSLVLHSLAENFCRQDLCTKGTTHIACQNVNGSFGSSCPKDATVIKLNLGDKNAL 65
            :::|...|..|..:   ||.:||....| .|..||.|.| |..|..||.:...::.:.. .:..|
  Fly     6 LTLFLCKILFLRSI---LAIDFCDIKSC-HGKRHIGCDN-NMMFDESCLRFHGLVNMAY-FREYL 64

  Fly    66 IKAHNLVRQKWASGKAKIKWTACKMAKMEWNKDLEKLAILNAKTCLMG--HDECHNTEKFRLSGQ 128
            :..||..||:.||........|.||.::.|:..|..:|..:.|.|.|.  .|.|..|:.|.    
  Fly    65 LGLHNGYRQEVASNLFVDLPPAQKMPELVWDNYLSVVAEYHLKRCQMDLPDDSCVATDDFS---- 125

  Fly   129 NLFAMGFSHARITKTKMNMTLSMLFEMAV--QKWAGEEKDITAEDLKKTTPNPPEVIGHLTVLIN 191
               ...|::|.....:..:..|.:.||.:  ::|..|..|:  :|:...:..     |.:..:||
  Fly   126 ---EPHFNYAEDFYPRPVIRQSNVREMTILAEQWLDELYDL--DDIATYSAE-----GEIRNIIN 180

  Fly   192 EKSNAVGCGL-VAYNLGEIRRYNLACNYAYTNVIGERVYEECAKAGIECAKGIDQKYPPLC 251
            ::|:.:||.. ..|:|..| .:.|.|.|:....:...:|||.......|..|...:||.||
  Fly   181 DRSSYMGCAAGQDYDLWNI-HFVLVCYYSSGPPVEGNLYEEGIFNATLCPNGQSDEYPNLC 240

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42780NP_001284979.1 SCP_euk 62..219 CDD:240180 40/161 (25%)
CG8072NP_648384.1 SCP_euk 61..208 CDD:240180 40/161 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45440681
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D109749at50557
OrthoFinder 1 1.000 - - FOG0000453
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.750

Return to query results.
Submit another query.