DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42780 and CG3640

DIOPT Version :9

Sequence 1:NP_001284979.1 Gene:CG42780 / 10178796 FlyBaseID:FBgn0261848 Length:254 Species:Drosophila melanogaster
Sequence 2:NP_611950.1 Gene:CG3640 / 37942 FlyBaseID:FBgn0035042 Length:296 Species:Drosophila melanogaster


Alignment Length:265 Identity:76/265 - (28%)
Similarity:127/265 - (47%) Gaps:35/265 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 VFTFNIFVLSLVLHSL------AENFCRQDLCTKGTTHIACQNVNGSFGSSCPKDATVIKLNLGD 61
            :|:..::.:.||:.:|      :.::|::..|.:.|.|:||.| ||:||..|.::|.:|.|:...
  Fly     1 MFSIRVWFICLVIVTLNSFPAYSWDYCQEHWCPRSTDHVACNN-NGTFGLDCGREARLIPLSNQL 64

  Fly    62 KNALIKAHNLVRQKWASGKAKIKWTACKMAKMEWNKDLEKLAILNAKTCLMGHDECHNTEKFR-- 124
            :..::...|..|.:.|||.......|.:||.:.|:.:|.:||.|.||.|.:..|.|.||.:|:  
  Fly    65 QAFIVHQVNFYRNQVASGGLSAFGPARRMASVRWDPELAQLAELAAKRCSLSGDGCRNTRRFKHV 129

  Fly   125 --LSGQNLFAMGFSHARITKTKMNMTLSMLFEMAVQKWAGE----EKDITAEDLKKTTPNPPEVI 183
              |:|..:|:.| .|:.:.          |....:..|.|:    .||:.|.|       |...|
  Fly   130 GQLTGHVIFSAG-KHSDLE----------LLRHKISNWFGQYMRASKDLQAAD-------PSSNI 176

  Fly   184 GHLTVLINEKSNAVGCGLVAYNLGEI-RRYNLACNYAYTNVIGERVYEECAKAGIECAKGIDQKY 247
            .....||.|.|..:|||::......: .:..:.||:|..|:..|:|| :...|...|..|.:.:|
  Fly   177 SSFRQLIQESSTHMGCGVLRQRSHMLWHQQFIVCNFARRNMPREQVY-QVGVAATGCRSGRNPRY 240

  Fly   248 PPLCA 252
            |.|||
  Fly   241 PNLCA 245

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42780NP_001284979.1 SCP_euk 62..219 CDD:240180 44/165 (27%)
CG3640NP_611950.1 SCP_euk 65..213 CDD:240180 44/165 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45440597
Domainoid 1 1.000 41 1.000 Domainoid score I8510
eggNOG 1 0.900 - - E1_COG2340
Homologene 1 1.000 - - H77274
Inparanoid 1 1.050 76 1.000 Inparanoid score I5251
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG26030
OrthoDB 1 1.010 - - D109749at50557
OrthoFinder 1 1.000 - - FOG0000453
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10334
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
109.910

Return to query results.
Submit another query.