DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42780 and CG43775

DIOPT Version :9

Sequence 1:NP_001284979.1 Gene:CG42780 / 10178796 FlyBaseID:FBgn0261848 Length:254 Species:Drosophila melanogaster
Sequence 2:NP_726425.3 Gene:CG43775 / 37863 FlyBaseID:FBgn0264297 Length:272 Species:Drosophila melanogaster


Alignment Length:277 Identity:71/277 - (25%)
Similarity:116/277 - (41%) Gaps:59/277 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 VLSLVLHSLA-ENFC--RQDLCTKG-TTHIACQ-------NVNGSFGSSCPKDATVIKLNLGDKN 63
            :|.|:|..:| .|:|  |..:|... ..|..|:       .....:.:|.|....|.|    |..
  Fly    10 LLLLLLPMVAGYNYCNNRTHVCDLAQRKHFMCRLGELKPYGGRAKYYASIPDTLKVRK----DTL 70

  Fly    64 ALIKAHNLVRQKWASGKA-----KIKWTACKMAKMEWNKDLEKLAILNAKTCLMGHDECHNTEKF 123
            |::   |..|...|.|:.     |...:|.:|..::|:.:|..:|..:|.|....|.||.:|.:|
  Fly    71 AVL---NTFRDMLAGGELDTAENKTFPSAKRMRALQWDSELAYMARTHAATVSFMHSECRSTLRF 132

  Fly   124 RLSGQNLFAMGFSHARITKTKMNMTLSMLFEMAVQKWAGEEKDITAEDLKKTTPNPPEV------ 182
            .|:|:.|........|::.|::   |.|:|.....::             ||..:|...      
  Fly   133 PLAGEVLALSPPVGHRLSLTEL---LRMVFAHIFDEY-------------KTVQDPQSFARRFDS 181

  Fly   183 -----IGHLTVLINEKSNAVGCGL-VAYNLGEIRR----YNLACNYAYTNVIGERVYEECAKAGI 237
                 :||.::::|::.:.||||. |..|..:..:    :.|.|::.||||.|..|| :..||..
  Fly   182 KRDYSVGHFSIIVNDRVSRVGCGFAVGSNCEKDGKVGFCHFLTCHFDYTNVNGSYVY-KTGKATT 245

  Fly   238 ECA--KGIDQ-KYPPLC 251
            .|.  |.|.. ||..||
  Fly   246 GCNDWKTIASIKYSNLC 262

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42780NP_001284979.1 SCP_euk 62..219 CDD:240180 40/177 (23%)
CG43775NP_726425.3 SCP_euk 66..228 CDD:240180 42/184 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45440683
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10334
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.850

Return to query results.
Submit another query.