DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42780 and CG17575

DIOPT Version :9

Sequence 1:NP_001284979.1 Gene:CG42780 / 10178796 FlyBaseID:FBgn0261848 Length:254 Species:Drosophila melanogaster
Sequence 2:NP_001188917.1 Gene:CG17575 / 36414 FlyBaseID:FBgn0250842 Length:298 Species:Drosophila melanogaster


Alignment Length:285 Identity:65/285 - (22%)
Similarity:117/285 - (41%) Gaps:50/285 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 IFVLSLVLHSL-AENFCRQDLCTKGTTHIACQNVNGSFGSSCPKDATVIKLNLGDKNALIKAHNL 71
            :.:|.|:...| |.::|...||.....||||.|. |:....|..||.::::....:..::...|.
  Fly    10 LLLLMLLGQQLQAFDYCDPTLCPGPERHIACNNF-GALADICSPDAHIVRITTARRTMILNELNE 73

  Fly    72 VRQKWASGKAKIKWTACKMAKMEWNKDLEKLAILNAKTCLMGHDECHNTEKFRLSGQNLFAMGFS 136
            .|.:.|.|.......|.:||.::|:::|...|.||.|.|.:.:|.|.|:|:||...|.:...|:.
  Fly    74 YRDRIARGDLMGFSPATRMATLQWDQELASFAELNVKRCALVNDHCRNSEQFRNVAQVVAEGGWQ 138

  Fly   137 HARITKTK---------------------MNMTLSMLFEMAVQKWAGEEKDITAEDLKKTTP--- 177
            ...:..:.                     :..||..:|        .|.|:.:..|:...:|   
  Fly   139 GDPLPPSSPSDPPNPEAPIPVEYHTEDEVIKATLEQMF--------AEYKECSMRDIIAFSPPNN 195

  Fly   178 -----NPPEVIGHLTVLINEKSNAVGCGLV----------AYNLGEIRRYNLACNYAYTNVIGER 227
                 ...:.|.:.|.|:.:.:..||||::          ..:|..:.:| :.||:..||.:...
  Fly   196 RILRLRVSKCIAYFTQLVRDSTTHVGCGILRQTKNTTNEAGQSLSSVHQY-MTCNFVRTNDVNAP 259

  Fly   228 VYEECAKAGIECAKGIDQKYPPLCA 252
            ||:...:...||..|.:..:..||:
  Fly   260 VYQSGDRPATECRSGRNPVFINLCS 284

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42780NP_001284979.1 SCP_euk 62..219 CDD:240180 40/195 (21%)
CG17575NP_001188917.1 SCP_euk 64..250 CDD:240180 39/194 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45440587
Domainoid 1 1.000 41 1.000 Domainoid score I8510
eggNOG 1 0.900 - - E1_COG2340
Homologene 1 1.000 - - H77274
Inparanoid 1 1.050 76 1.000 Inparanoid score I5251
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG26030
OrthoDB 1 1.010 - - D109749at50557
OrthoFinder 1 1.000 - - FOG0000453
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10334
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
109.910

Return to query results.
Submit another query.