DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42780 and CG10651

DIOPT Version :9

Sequence 1:NP_001284979.1 Gene:CG42780 / 10178796 FlyBaseID:FBgn0261848 Length:254 Species:Drosophila melanogaster
Sequence 2:NP_001286095.1 Gene:CG10651 / 35303 FlyBaseID:FBgn0032853 Length:316 Species:Drosophila melanogaster


Alignment Length:251 Identity:67/251 - (26%)
Similarity:112/251 - (44%) Gaps:37/251 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 AENFCRQDLCTKGTTHIACQNVNGSFGSSCPKD-ATVIKLNLGDKNALIKAHNLVRQKWASGKAK 82
            ::.:|:.||| :| .|:.|.: ||:|.|:|||. |.::|::......::..||..|.|:|.|..:
  Fly    20 SDKWCKADLC-RG-QHVLCDD-NGNFESTCPKQAAAMVKMSWDMIALIVDKHNEYRNKFAGGMDQ 81

  Fly    83 IKWTACKMAKMEWNKDLEKLAILNAKTCLMGHDECHNTEKFRLSGQNLFAMGFSHARITKTKMNM 147
             ...|.:|..:||:.:|.|:|....:.|....|:|..|.            .:.||.:     :.
  Fly    82 -NPKAARMTTIEWDPELAKVADGLVRRCEPIRDQCAITP------------NYGHAEV-----SY 128

  Fly   148 TLSMLFEMAVQKWA----------GEEKDITAEDLKKTTPNPPEVIGHLTVLINEKSNAVGCGLV 202
            :|...|.|..:|.|          ...||...:.....|.|..|:..:...::.:::|.|||.:|
  Fly   129 SLEKYFCMTTKKEALRKQLDHWFDPNSKDEVQKLFFSWTKNQQELSKNYFQVLRDRANRVGCAIV 193

  Fly   203 AYNLGEIRRYNLACNYAYTNVIGER----VYEEC-AKAGIECAKGIDQKYPPLCAK 253
            .|....:....|.|.|.....:.|.    |||:. .:|..||.||.:::|..||.|
  Fly   194 EYVRPALVHQLLKCVYNCGVSLCEEEDNPVYEDTDEEAASECMKGSNKQYKNLCHK 249

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42780NP_001284979.1 SCP_euk 62..219 CDD:240180 37/166 (22%)
CG10651NP_001286095.1 SCP_euk 61..210 CDD:240180 37/166 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45440686
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 76 1.000 Inparanoid score I5251
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D109749at50557
OrthoFinder 1 1.000 - - FOG0000453
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10334
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
76.900

Return to query results.
Submit another query.