DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42780 and CG16995

DIOPT Version :9

Sequence 1:NP_001284979.1 Gene:CG42780 / 10178796 FlyBaseID:FBgn0261848 Length:254 Species:Drosophila melanogaster
Sequence 2:NP_608668.2 Gene:CG16995 / 33413 FlyBaseID:FBgn0031412 Length:146 Species:Drosophila melanogaster


Alignment Length:171 Identity:34/171 - (19%)
Similarity:56/171 - (32%) Gaps:46/171 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    65 LIKAHNLVRQKWASGKAKIKWTACKMAKMEWNKDLEKLAILNAKTCLMGHDECHNTEKFRLSGQN 129
            :::||||.|.|..:....:.....::| .||...|     |:........:..:....:..||.|
  Fly    10 VLQAHNLYRAKHGAQPLTLSPKLNRLA-TEWANYL-----LSRNRMEHRQNSGYGENIYMASGGN 68

  Fly   130 LFAMGFSHARITKTKMNMTLSMLFEMAVQKWAGEEKDITAEDLKKTTPNPPEV---IGHLTVLIN 191
            |....                     ||:.|        .|::::...|.|..   .||.|.::.
  Fly    69 LKGAD---------------------AVRSW--------YEEIRQYNWNSPSFQGNTGHFTQVVW 104

  Fly   192 EKSNAVGCGLVAYNLGEIRRYNLACNY----AYTNVIGERV 228
            :.|..:|.|.....    ....:.|||    .|.|:..|.|
  Fly   105 KSSTELGVGFAKSG----STIYVVCNYNPPGNYNNLFRENV 141

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42780NP_001284979.1 SCP_euk 62..219 CDD:240180 30/160 (19%)
CG16995NP_608668.2 SCP_GAPR-1_like 5..125 CDD:240182 27/153 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45455098
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10334
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.850

Return to query results.
Submit another query.