DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42780 and CG4270

DIOPT Version :9

Sequence 1:NP_001284979.1 Gene:CG42780 / 10178796 FlyBaseID:FBgn0261848 Length:254 Species:Drosophila melanogaster
Sequence 2:NP_608663.1 Gene:CG4270 / 33408 FlyBaseID:FBgn0031407 Length:170 Species:Drosophila melanogaster


Alignment Length:210 Identity:45/210 - (21%)
Similarity:70/210 - (33%) Gaps:80/210 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 QDLCTKGTTHIACQNVNGSFGS-----SCPKDATVIKLNLGDKNALIKAHNLVRQKWASGKAKIK 84
            ||  |||...:..:.|..:...     .||    .:.:|        .|.|.:.|:||:      
  Fly    22 QD--TKGNNELFLKEVFNTTNKYRAMHGCP----AVTIN--------AALNKLAQEWAN------ 66

  Fly    85 WTACKMAKMEWNKDLEKLAILNAKTCLMGHDECHNTEKFRLS---GQNLFAMGFSHARITKTKMN 146
                                         |....||...|.:   |:|:|..|         .|:
  Fly    67 -----------------------------HLRDQNTMAHRPNPKYGENIFLSG---------GMD 93

  Fly   147 MTLSMLFEMAVQKWAGEEKDITAEDLKKTTPNPPEVIGHLTVLINEKSNAVGCGLVAYNLGEIRR 211
            :|    .::.|:.|   .::|.:.|..|....|  ..||.|.||.:.|..:|.|:..    :..|
  Fly    94 VT----GDLPVEMW---YREINSYDFNKAQFVP--TAGHFTQLIWKSSVEMGSGVAR----KADR 145

  Fly   212 YNLACNY-AYTNVIG 225
            ..:.||| ...||:|
  Fly   146 TWVVCNYNPPGNVVG 160

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42780NP_001284979.1 SCP_euk 62..219 CDD:240180 33/160 (21%)
CG4270NP_608663.1 SCP_GAPR-1_like 31..158 CDD:240182 37/195 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45455140
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10334
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.850

Return to query results.
Submit another query.