DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42780 and CG9400

DIOPT Version :9

Sequence 1:NP_001284979.1 Gene:CG42780 / 10178796 FlyBaseID:FBgn0261848 Length:254 Species:Drosophila melanogaster
Sequence 2:NP_572957.1 Gene:CG9400 / 32385 FlyBaseID:FBgn0030562 Length:308 Species:Drosophila melanogaster


Alignment Length:246 Identity:82/246 - (33%)
Similarity:126/246 - (51%) Gaps:30/246 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 FCRQDLCT--KGT-----THIACQNVNGSFGSSCPKDATVIKLNLGDKNALIKAHNLVRQKWASG 79
            :|...||.  .||     .|.||.| ||||..:|..:..:::::...:..|:..|||.|.|.|||
  Fly    50 YCAAALCELYNGTHLVHVPHTACGN-NGSFSPACGPEPKLLEMSERRRQLLLDMHNLARSKIASG 113

  Fly    80 KAKIKWTACKMAKMEWNKDLEKLAILNAKTCLMGHDECHNTEKFRLSGQNL--FAMG---FSHAR 139
            ......:|..|..:.|:.:||::|.|:||.|...||:|.||.:|:.||||:  |.:|   .||:|
  Fly   114 NLDGYRSAAHMPLLRWDTELEQMAALHAKRCQFAHDKCRNTPRFKFSGQNIGYFWIGREFKSHSR 178

  Fly   140 ITKTKMNMTLSMLFEMAVQKWAGEEKDITAEDLKKTTPNPP-EVIGHLTVLINEKSNAVGCGLVA 203
            ..|:            .|..|..|.:|.....:.:..|:|. :.|||.|:|::::.|.|||..|.
  Fly   179 RMKS------------FVINWFREHQDANQSFIDRYHPHPQGKKIGHFTLLVSDRVNRVGCAGVR 231

  Fly   204 YNLGEIRRYN--LACNYAYTNVIGERVYEECAKAGIECAK-GIDQKYPPLC 251
            :...:..|:.  |.|||.|.|:..|.:|:. ..||.:|.: .|.:|:|.||
  Fly   232 FLEPKSNRFQFMLTCNYDYNNIFNEPIYQS-GPAGSKCPQHRISEKFPSLC 281

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42780NP_001284979.1 SCP_euk 62..219 CDD:240180 55/164 (34%)
CG9400NP_572957.1 SCP_euk 96..249 CDD:240180 55/164 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45440685
Domainoid 1 1.000 41 1.000 Domainoid score I8510
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 76 1.000 Inparanoid score I5251
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG26030
OrthoDB 1 1.010 - - D102857at33392
OrthoFinder 1 1.000 - - FOG0000453
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10334
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
88.010

Return to query results.
Submit another query.