DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42780 and CG31296

DIOPT Version :9

Sequence 1:NP_001284979.1 Gene:CG42780 / 10178796 FlyBaseID:FBgn0261848 Length:254 Species:Drosophila melanogaster
Sequence 2:NP_001262608.1 Gene:CG31296 / 318668 FlyBaseID:FBgn0051296 Length:280 Species:Drosophila melanogaster


Alignment Length:260 Identity:67/260 - (25%)
Similarity:124/260 - (47%) Gaps:24/260 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSVFTFNIFVLSLVLHSLAE--NFCRQDLCTKGTTHIACQNVNGSFGSSCPKDATVIKLNLGDKN 63
            :|.|.| :.:|:.:....::  :||:...|  ||.::||.|.: .|...||.:|..:.::. .:|
  Fly     3 LSGFIF-VALLNFIPFGCSKLVDFCQLPYC--GTNNLACNNPS-KFSVMCPPNARTLSMST-YRN 62

  Fly    64 ALIKAHNLVRQKWASGKAK-IKWTACKMAKMEWNKDLEKLAILNAKTCLMGHDECHNTEKFRLSG 127
            .|:.|.|..|...||||.| :|..|.:|:::.::.:||.||.|...|| ..|..|.|:::|...|
  Fly    63 LLLIAFNEFRNYTASGKQKYLKAAAARMSRLSYSMELEDLARLAVITC-STHKFCLNSQEFYYVG 126

  Fly   128 QNLFAMGFSHARITKTKMNMTLSMLFEMAVQKWAGEEKDITAEDLKKTTPNPPEV----IGHLTV 188
            .|:   |.:| .:........|.::..: :|.|......:   ::|.....|..:    |....:
  Fly   127 TNI---GSTH-YLGNLNDYEDLELMLRI-IQHWTRYADYV---NIKMGVYMPTTLGKSGIAKALL 183

  Fly   189 LINEKSNAVGCGLVAYNLGEIRRYNLACNYAYTNVIGER-VYEECAKAGIECAKGIDQKYPPLCA 252
            |:.:::..|||..:.:.:..:..:...|.:: |::..|| :|....:.|..| |.:|..|..|||
  Fly   184 LMADRNTHVGCSAMRFTVHSVHNFVFLCAFS-TDLFVERPIYRMSMRPGAAC-KRLDPTYSALCA 246

  Fly   253  252
              Fly   247  246

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42780NP_001284979.1 SCP_euk 62..219 CDD:240180 39/161 (24%)
CG31296NP_001262608.1 SCP_euk 61..214 CDD:240180 39/161 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 41 1.000 Domainoid score I8510
eggNOG 1 0.900 - - E1_COG2340
Homologene 1 1.000 - - H77274
Inparanoid 1 1.050 71 1.000 Inparanoid score I3895
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D109749at50557
OrthoFinder 1 1.000 - - FOG0000453
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10334
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
87.970

Return to query results.
Submit another query.