DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42780 and CG31286

DIOPT Version :9

Sequence 1:NP_001284979.1 Gene:CG42780 / 10178796 FlyBaseID:FBgn0261848 Length:254 Species:Drosophila melanogaster
Sequence 2:NP_731103.1 Gene:CG31286 / 318662 FlyBaseID:FBgn0051286 Length:205 Species:Drosophila melanogaster


Alignment Length:54 Identity:16/54 - (29%)
Similarity:22/54 - (40%) Gaps:11/54 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 ENFCRQDLCTKGTTHIACQN-VNG-SFGSSCP--KDATV------IKLNLGDKN 63
            |:.||.:: .:|......:| .|| .|....|  ||.|.      :.|..||.|
  Fly    83 ESICRFEV-KRGALSRCVKNWYNGRKFDILDPKAKDFTAMIWRSSVSLGYGDAN 135

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42780NP_001284979.1 SCP_euk 62..219 CDD:240180 1/2 (50%)
CG31286NP_731103.1 SCP 27..153 CDD:294090 16/54 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45455161
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10334
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.940

Return to query results.
Submit another query.