powered by:
Protein Alignment CG42780 and CG31286
DIOPT Version :9
Sequence 1: | NP_001284979.1 |
Gene: | CG42780 / 10178796 |
FlyBaseID: | FBgn0261848 |
Length: | 254 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_731103.1 |
Gene: | CG31286 / 318662 |
FlyBaseID: | FBgn0051286 |
Length: | 205 |
Species: | Drosophila melanogaster |
Alignment Length: | 54 |
Identity: | 16/54 - (29%) |
Similarity: | 22/54 - (40%) |
Gaps: | 11/54 - (20%) |
- Green bases have known domain annotations that are detailed below.
Fly 20 ENFCRQDLCTKGTTHIACQN-VNG-SFGSSCP--KDATV------IKLNLGDKN 63
|:.||.:: .:|......:| .|| .|....| ||.|. :.|..||.|
Fly 83 ESICRFEV-KRGALSRCVKNWYNGRKFDILDPKAKDFTAMIWRSSVSLGYGDAN 135
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
CG42780 | NP_001284979.1 |
SCP_euk |
62..219 |
CDD:240180 |
1/2 (50%) |
CG31286 | NP_731103.1 |
SCP |
27..153 |
CDD:294090 |
16/54 (30%) |
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
1 |
0.930 |
- |
- |
|
C45455161 |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_COG2340 |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
1 |
1.010 |
- |
- |
|
D1528782at2759 |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
1 |
1.100 |
- |
- |
P |
PTHR10334 |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
|
4 | 3.940 |
|
Return to query results.
Submit another query.