DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42780 and Crispld1

DIOPT Version :9

Sequence 1:NP_001284979.1 Gene:CG42780 / 10178796 FlyBaseID:FBgn0261848 Length:254 Species:Drosophila melanogaster
Sequence 2:NP_001128435.1 Gene:Crispld1 / 316482 RGDID:1564813 Length:500 Species:Rattus norvegicus


Alignment Length:218 Identity:54/218 - (24%)
Similarity:82/218 - (37%) Gaps:56/218 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    61 DKNALIKAHNLVRQKWASGKAKIKWTACKMAKMEWNKDLEKLAILNAKTCLMGHDECHNTEKFRL 125
            |..:::..||.:|       :::...|..|..|.|:.:||:.|...|:|||..|..   |.....
  Rat    61 DMQSILDLHNKLR-------SQVYPAASNMEYMTWDVELERSAESWAETCLWEHGP---TSLLPS 115

  Fly   126 SGQNLFAMGFSHARITKTKMNMTLSMLFEMAVQKWAGEEKDITAEDLKKTTPNPP-----EVIGH 185
            .||||   |....|......:          ||.|..|.:|.:.....:..|..|     .|..|
  Rat   116 IGQNL---GAHWGRYRPPTFH----------VQAWYDEVRDFSYPYEHECDPYCPFRCSGPVCTH 167

  Fly   186 LTVLINEKSNAVGCGL-VAYNL---GEI--RRYNLACNYA-YTNVIGERVYEECAKAGIECA--- 240
            .|.::...|:.:||.: :.:|:   |:|  :...|.|||: ..|..|...|    |.|..|:   
  Rat   168 YTQVVWATSSRIGCAINLCHNMNIWGQIWPKAVYLVCNYSPKGNWWGHAPY----KHGKPCSACP 228

  Fly   241 --------------KGIDQKYPP 249
                          :|.||.|.|
  Rat   229 PSFGGGCRENLCYKEGSDQYYTP 251

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42780NP_001284979.1 SCP_euk 62..219 CDD:240180 41/167 (25%)
Crispld1NP_001128435.1 SCP_euk 63..207 CDD:240180 41/166 (25%)
LCCL 291..375 CDD:128866
LCCL 394..492 CDD:281766
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166344634
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10334
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.850

Return to query results.
Submit another query.