DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42780 and Clec18a

DIOPT Version :9

Sequence 1:NP_001284979.1 Gene:CG42780 / 10178796 FlyBaseID:FBgn0261848 Length:254 Species:Drosophila melanogaster
Sequence 2:XP_038954171.1 Gene:Clec18a / 307851 RGDID:1559899 Length:497 Species:Rattus norvegicus


Alignment Length:179 Identity:38/179 - (21%)
Similarity:70/179 - (39%) Gaps:36/179 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    49 PKDATVIK-LNLGDKNALIKAHNLVRQKWASGKAKIKWTACKMAKMEWNKDLEKLAILNAKTCLM 112
            ||...::: |:..:...::..||.:|       :::..:|..|.:|:|::.|.:||  .|:..|.
  Rat    61 PKQVPIVQALSRKESFLILTTHNRLR-------SQVHPSAANMQRMDWSESLAQLA--QARAALC 116

  Fly   113 GHDECHNTEKFRLSGQNLFAMGFSHARITKTKMNMTL----SMLFEMAVQKWAGE---EKDITAE 170
            |...   |.....:.:|...:|:          |:.|    |..|...|..|..|   .:..:||
  Rat   117 GTSA---TPNLAATLRNTPDVGW----------NVQLLPMGSASFVEVVNVWFAEGLQYRHGSAE 168

  Fly   171 DLKKTTPNPPEVIGHLTVLINEKSNAVGCGLVAYNLGEIRRYNLACNYA 219
            .....|      ..|.|.|:...|:.:|||.....:.::......|.|:
  Rat   169 CAHNAT------CAHYTQLVWATSSQLGCGWQPCFVDQVATEAFVCAYS 211

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42780NP_001284979.1 SCP_euk 62..219 CDD:240180 34/163 (21%)
Clec18aXP_038954171.1 CAP_euk 77..211 CDD:349399 34/161 (21%)
CLECT 361..485 CDD:153057
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166344567
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.940

Return to query results.
Submit another query.