DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42780 and antr

DIOPT Version :9

Sequence 1:NP_001284979.1 Gene:CG42780 / 10178796 FlyBaseID:FBgn0261848 Length:254 Species:Drosophila melanogaster
Sequence 2:NP_001246284.1 Gene:antr / 246647 FlyBaseID:FBgn0050488 Length:272 Species:Drosophila melanogaster


Alignment Length:280 Identity:65/280 - (23%)
Similarity:109/280 - (38%) Gaps:60/280 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSVFTFNIFVLSLVLHSLAEN--FCRQDLCTKGTTHIACQNVNGSFGSSCPKDATVIKLNLGDKN 63
            |.::...:|:|.|....:.|:  .|:.:||.....|:.|.... :.|..|.|:...:.:|...|.
  Fly     1 MKMWYLYLFLLPLTASLIPEDDPHCKPNLCMNSEIHVGCFQPK-AVGEQCGKNNLFLNVNGALKT 64

  Fly    64 ALIKAHNLVRQKWASGKAKIKWTACKMAKMEWNKDLEKLAILNAKTCLMGHDE----CHNTEKFR 124
            .::...|::|...|||..... .|.:|..|.|:.:|::||....:.|    ||    |.||:|:.
  Fly    65 GILSRINMLRNYVASGVGNYS-VAARMPTMGWDFELQRLADRQVRQC----DETGKFCANTDKYH 124

  Fly   125 LSGQNLFAMGFSHARITKTKMNMTLSMLFEMAVQKWAGEEKDITAEDLKKTTP-----------N 178
                        :...|:.:..|              |..|.:.:..|.|..|           |
  Fly   125 ------------YVATTEIRSKM--------------GRTKSLKSAILDKLLPELFLDVMGCMMN 163

  Fly   179 PPEV--------IGHLTVLINEKSNAVGCGLVAYNLGEIRRYN--LACNYAYTNVIGERVYEECA 233
            ..::        :||...||.:..:.:||||......| :..|  |.|:::..:|.....|||..
  Fly   164 SQKLVPVREGTCVGHYMPLIQDHGSRMGCGLRVKGRDE-KESNIILLCHFSRASVNNLVPYEEGQ 227

  Fly   234 KAGIECAKGIDQKYPPLCAK 253
            ....:||.|..|.|..||::
  Fly   228 IPAGKCATGPSQMYQFLCSE 247

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42780NP_001284979.1 SCP_euk 62..219 CDD:240180 40/181 (22%)
antrNP_001246284.1 SCP_euk 63..213 CDD:240180 40/181 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45440680
Domainoid 1 1.000 41 1.000 Domainoid score I8510
eggNOG 1 0.900 - - E1_COG2340
Homologene 1 1.000 - - H77274
Inparanoid 1 1.050 71 1.000 Inparanoid score I3895
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D109749at50557
OrthoFinder 1 1.000 - - FOG0000453
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
87.800

Return to query results.
Submit another query.