DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42780 and D2062.1

DIOPT Version :9

Sequence 1:NP_001284979.1 Gene:CG42780 / 10178796 FlyBaseID:FBgn0261848 Length:254 Species:Drosophila melanogaster
Sequence 2:NP_001293506.1 Gene:D2062.1 / 24104374 WormBaseID:WBGene00017055 Length:204 Species:Caenorhabditis elegans


Alignment Length:149 Identity:32/149 - (21%)
Similarity:53/149 - (35%) Gaps:42/149 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    62 KNALIKAHNLVRQKWAS---------GKAKIKWTACKMAKMEWNKDLEKLAILNAKTCLMGHDEC 117
            |..::..|||.|.|..:         ..|..:| |.:|||..|                :.|   
 Worm    48 KELIVAYHNLYRSKHGAPPLVADPVMDVAAKRW-ADEMAKSGW----------------ISH--- 92

  Fly   118 HNTEKFRLSGQNLFAMGFSHARITKTKMNMTLSMLFEMAVQKWAGEEKDITAEDLKKTTPNPPEV 182
               ||.|..|:|: || |..:........:..:|:....::....:......|.||:.       
 Worm    93 ---EKPRKYGENV-AM-FCQSGCWPLPQTLAQAMVHLFYIEGIGYDYSSFKPELLKEN------- 145

  Fly   183 IGHLTVLINEKSNAVGCGL 201
             ||.|.::.:.|..:|.|:
 Worm   146 -GHFTQIVWKSSRKIGVGI 163

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42780NP_001284979.1 SCP_euk 62..219 CDD:240180 32/149 (21%)
D2062.1NP_001293506.1 CAP_GAPR1-like 46..189 CDD:349401 32/149 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.