DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42780 and Crisp2

DIOPT Version :9

Sequence 1:NP_001284979.1 Gene:CG42780 / 10178796 FlyBaseID:FBgn0261848 Length:254 Species:Drosophila melanogaster
Sequence 2:NP_001191000.1 Gene:Crisp2 / 22024 MGIID:98815 Length:243 Species:Mus musculus


Alignment Length:254 Identity:55/254 - (21%)
Similarity:92/254 - (36%) Gaps:65/254 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSVFTFNIFVLSLVLHSLAENFCRQDLCTKGTTHIACQNVNGSFGSSCPKDATVIKLNLGDKNAL 65
            |:.|...:||.:|:|.|         ..|:|..               |...:::...|..:..:
Mouse     1 MAWFQVMLFVFALLLRS---------PLTEGKD---------------PDFTSLLTNQLQVQREI 41

  Fly    66 IKAHNLVRQKWASGKAKIKWTACKMAKMEWNKDLEKLAILNAKTCLMGHDECHNTEKFRLSGQNL 130
            :..||.:|:       .:..|...:.||||:......|...|..|::.|....:.:.....|:||
Mouse    42 VNKHNELRR-------SVNPTGSDILKMEWSIQATTNAQKWANKCILEHSSKDDRKINIRCGENL 99

  Fly   131 FAMGFSHARITKTKMNMTLSMLFEMAVQKWAGEEKDITAEDLKKTTPNPPEVIGHLTVLINEKSN 195
            :.              .|...|:...:|.|..|.:|.    :......|...:||.|.|:...|.
Mouse   100 YM--------------STDPTLWSTVIQSWYNENEDF----VYGVGAKPNSAVGHYTQLVWYSSF 146

  Fly   196 AVGCGLVAY-----NLGEIRRYNLACNYA--YTNVIGERV-YEE---CAKAGIECAKGI 243
            .:||| :||     ||    :|...|:|.  ..||:.:.. |::   ||.....|..|:
Mouse   147 KIGCG-IAYCPNQDNL----KYFYVCHYCPMGNNVMKKSTPYQQGTPCASCPNNCENGL 200

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42780NP_001284979.1 SCP_euk 62..219 CDD:240180 36/161 (22%)
Crisp2NP_001191000.1 SCP_CRISP 36..171 CDD:240183 37/164 (23%)
Crisp 189..243 CDD:285731 4/12 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167841363
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.750

Return to query results.
Submit another query.