DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42780 and scl-25

DIOPT Version :9

Sequence 1:NP_001284979.1 Gene:CG42780 / 10178796 FlyBaseID:FBgn0261848 Length:254 Species:Drosophila melanogaster
Sequence 2:NP_507364.1 Gene:scl-25 / 188600 WormBaseID:WBGene00011841 Length:212 Species:Caenorhabditis elegans


Alignment Length:208 Identity:39/208 - (18%)
Similarity:62/208 - (29%) Gaps:90/208 - (43%)


- Green bases have known domain annotations that are detailed below.


  Fly   101 KLAILNAKTCLMGHDECHNTEKFRLSGQNLFAMGFSHAR--------------ITKTKMNMTL-- 149
            ||.||........|.:.|...:.|.:.:.:..:.|.|.:              |:|:. ||.|  
 Worm     2 KLIILLLALTAAAHADRHFNPQHRWNAEAIDNIVFIHNKLRNAASHGLWERHSISKSS-NMQLLS 65

  Fly   150 ---SMLFEMAVQKWAGE----------------EKDITAED----------LKKTT-----PNPP 180
               |::.|...:|:..|                :.|:...|          :.|.|     ....
 Worm    66 WNESLVAEAENEKYYCEPADNKNLPIKLGDNIYQYDVNTYDDIDGVGAMGSINKDTHDALKSEAK 130

  Fly   181 EVIGHLTVLINEKSNAVGCGLVAYNLGEIRRYNLACNYAYTNVIGERVYEECAKAGIECAKGIDQ 245
            .....|..::..||.::||                            :||.|.|..   :|||:.
 Worm   131 AAKNRLRQMLYSKSKSIGC----------------------------IYESCDKID---SKGINY 164

  Fly   246 -------KY-PPL 250
                   || |||
 Worm   165 NTRLLICKYSPPL 177

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42780NP_001284979.1 SCP_euk 62..219 CDD:240180 27/167 (16%)
scl-25NP_507364.1 CAP_euk 31..174 CDD:349399 28/174 (16%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10334
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.