DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42780 and C07A4.2

DIOPT Version :9

Sequence 1:NP_001284979.1 Gene:CG42780 / 10178796 FlyBaseID:FBgn0261848 Length:254 Species:Drosophila melanogaster
Sequence 2:NP_509706.2 Gene:C07A4.2 / 182351 WormBaseID:WBGene00007397 Length:417 Species:Caenorhabditis elegans


Alignment Length:227 Identity:47/227 - (20%)
Similarity:67/227 - (29%) Gaps:78/227 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly    46 SSCPKDATVIKL-NLGD------------------------KNALIKAHNLVRQKWASGKAKIKW 85
            :|.|.|..|.:| |:|.                        |..|:..||:.|.|..: .|.|..
 Worm   212 ASVPLDTDVKRLSNIGAIKSYLFSKSKVDKQDPARYDIPKLKEWLVSYHNVYRSKHGA-PALISD 275

  Fly    86 TACKMAKMEWNKDLEKLAILNAKTCLMGHDECHNTEKFRLSGQNLFAMGFSHARITKTKMNMTLS 150
            :........|..:|..            |..|...|:.|..|:|||..|..|....:|.....:.
 Worm   276 SVLDSRGKRWADELAY------------HKGCLVHEQPRTYGENLFFFGARHLPSPQTLAAAVIQ 328

  Fly   151 MLFEMAV----QKWAGEEKDITAEDLKKTTPNPPEVIGHLTVLINEKSNAVGCGLVAYNLGEIR- 210
            ..:...:    ..|       ......||        ||.|.||.:.|..:|.|:.......|| 
 Worm   329 SFYLEGIGYNYSSW-------RPMSFFKT--------GHFTQLIWKNSRKIGVGVSIVKSSSIRS 378

  Fly   211 ----------------RYNLACNY----AYTN 222
                            :|:.|.|:    ||.|
 Worm   379 PCVSSSPNMYFIYVVVKYDPAGNFESHKAYLN 410

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42780NP_001284979.1 SCP_euk 62..219 CDD:240180 37/181 (20%)
C07A4.2NP_509706.2 CAP_GAPR1-like 251..402 CDD:349401 36/178 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.