DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42780 and vap-2

DIOPT Version :9

Sequence 1:NP_001284979.1 Gene:CG42780 / 10178796 FlyBaseID:FBgn0261848 Length:254 Species:Drosophila melanogaster
Sequence 2:NP_001300377.1 Gene:vap-2 / 181273 WormBaseID:WBGene00011462 Length:507 Species:Caenorhabditis elegans


Alignment Length:240 Identity:61/240 - (25%)
Similarity:95/240 - (39%) Gaps:68/240 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 GSF--GSSCPKDATVIKLNLGDKNALIKAHNLVRQKWASGKAKIKWT---------ACKMAKMEW 95
            |||  .:|...|.|        :|..::.||..|.:.|.|   .:|.         |.:|.|||:
 Worm   302 GSFQCDNSLVSDVT--------RNFTLEQHNFYRSRLAKG---FEWNGETNTSQPKASQMIKMEY 355

  Fly    96 NKDLEKLAILNAKTCLMGHDECHNTEKFRLSGQNLFAMGFSHARITKTKMNMTLSMLFEMAVQKW 160
            :..||:.|...|..|:..|...:....   .||||:...||         |.....|...||:||
 Worm   356 DCMLERFAQNWANNCVFAHSAHYERPN---QGQNLYMSSFS---------NPDPRSLIHTAVEKW 408

  Fly   161 AGEEKD--------ITAE--DLKKTTPNPPEVIGHLTVLINEKSNAVGCGL-----VAYNLGEIR 210
            ..|.::        :|.|  |||      .:.|||.|.:..:::..:|||:     ::|      
 Worm   409 WQELEEFGTPIDNVLTPELWDLK------GKAIGHYTQMAWDRTYRLGCGIANCPKMSY------ 461

  Fly   211 RYNLACNYAYT-NVIGERVYE--ECAKAGIECAKGID-QKYPPLC 251
               :.|:|... |....::||  :..:...:|..|.| :|...||
 Worm   462 ---VVCHYGPAGNRKNNKIYEIGDPCEVDDDCPIGTDCEKTTSLC 503

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42780NP_001284979.1 SCP_euk 62..219 CDD:240180 45/180 (25%)
vap-2NP_001300377.1 SCP 104..253 CDD:214553
SCP 315..468 CDD:214553 47/190 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10334
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.