DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42780 and scl-5

DIOPT Version :9

Sequence 1:NP_001284979.1 Gene:CG42780 / 10178796 FlyBaseID:FBgn0261848 Length:254 Species:Drosophila melanogaster
Sequence 2:NP_502506.1 Gene:scl-5 / 178253 WormBaseID:WBGene00008027 Length:208 Species:Caenorhabditis elegans


Alignment Length:206 Identity:55/206 - (26%)
Similarity:83/206 - (40%) Gaps:40/206 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    64 ALIKAHNLVRQKWASG----KAKIKWTACKMAKMEWNKDLEKLAILNAKTCLMGHDECHNTEKFR 124
            |::..||.:|.:.|.|    |...|..|..|.||:|:..:...|...|..|..||......    
 Worm    26 AILNVHNTLRSRIAKGTYVAKGTAKPAASDMLKMKWDATVAASAQAYANKCPTGHSGAAGL---- 86

  Fly   125 LSGQNLFAMGFSHARITK-TKMNMTLSMLFEMAVQKWAGEEKDITAEDLKKTTPNPPEVIGHLTV 188
              |:||: ..::.|.||. .:...|.|..:|...|.: |...:..:..|..|.      |||.|.
 Worm    87 --GENLY-WYWTSATITNIDQFGATGSAAWEKEFQDY-GWSSNTLSMSLFNTG------IGHATQ 141

  Fly   189 LINEKSNAVGCGLVAYNLGE----IRRYNLACNY-AYTNVIGERVYEE---CAK--AGIEC--AK 241
            :...|:|.:|||:  .|.|:    ..:..:.|.| ...|.:.:.:|..   |:|  :|..|  |.
 Worm   142 MAWAKTNLIGCGV--KNCGKDTNGFNKVTVVCQYKPQGNYLNQNIYTSGTTCSKCPSGTSCEAAT 204

  Fly   242 GIDQKYPPLCA 252
            |       |||
 Worm   205 G-------LCA 208

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42780NP_001284979.1 SCP_euk 62..219 CDD:240180 44/164 (27%)
scl-5NP_502506.1 SCP 22..175 CDD:214553 44/164 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 41 1.000 Domainoid score I8510
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 71 1.000 Inparanoid score I3895
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10334
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.970

Return to query results.
Submit another query.