DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42780 and scl-2

DIOPT Version :9

Sequence 1:NP_001284979.1 Gene:CG42780 / 10178796 FlyBaseID:FBgn0261848 Length:254 Species:Drosophila melanogaster
Sequence 2:NP_502503.1 Gene:scl-2 / 178251 WormBaseID:WBGene00009895 Length:207 Species:Caenorhabditis elegans


Alignment Length:213 Identity:52/213 - (24%)
Similarity:81/213 - (38%) Gaps:40/213 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 IACQNVNGSFGSSCPKDATVIKLNLGDKNALIKAHNLVRQKWASG----KAKIKWTACKMAKMEW 95
            :.|   :..||||             .:|.:|.|||.:|.|.|.|    |...|.....:.||:|
 Worm    12 VGC---SADFGSS-------------GQNGIINAHNTLRSKIAKGTYVAKGTQKSPGTNLLKMKW 60

  Fly    96 NKDLEKLAILNAKTCLMGHDECHNTEKFRLSGQNLFAMGFSHARITKTKMNMTLSMLFEMAVQKW 160
            :..:...|...|..|..||......      |:||:....|.:.....:.....|..:|...|.:
 Worm    61 DSAVAASAQNYANGCPTGHSGDAGL------GENLYWYWTSGSLGDLNQYGSAASASWEKEFQDY 119

  Fly   161 AGEEKDITAEDLKKTTPNPPEVIGHLTVLINEKSNAVGCGL--VAYNLGEIRRYNLACNY-AYTN 222
             |.:.::...||..|.      |||.|.:...|||.:|||:  ...:...:.:..:.|.| ...|
 Worm   120 -GWKSNLMTIDLFNTG------IGHATQMAWAKSNLIGCGVKDCGRDSNGLNKVTVVCQYKPQGN 177

  Fly   223 VIGERVYEECAKAGIECA 240
            .|.:.:|    .:|..|:
 Worm   178 FINQYIY----VSGATCS 191

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42780NP_001284979.1 SCP_euk 62..219 CDD:240180 42/163 (26%)
scl-2NP_502503.1 SCP 21..174 CDD:214553 43/178 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 41 1.000 Domainoid score I8510
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 71 1.000 Inparanoid score I3895
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10334
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
55.070

Return to query results.
Submit another query.