DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42780 and lon-1

DIOPT Version :9

Sequence 1:NP_001284979.1 Gene:CG42780 / 10178796 FlyBaseID:FBgn0261848 Length:254 Species:Drosophila melanogaster
Sequence 2:NP_498166.1 Gene:lon-1 / 175753 WormBaseID:WBGene00003055 Length:312 Species:Caenorhabditis elegans


Alignment Length:156 Identity:35/156 - (22%)
Similarity:54/156 - (34%) Gaps:48/156 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    87 ACKMAKMEWNKDLEKLAILNAKTCLMGHDECHNTEKFRLSGQNLFAMGFSHARITKTKMNMTLSM 151
            |..|..:.|:.:|...|..:|.||    |..|:..:..: |:|::|..:|:              
 Worm    97 ASDMNMLYWSDELAASAQRHADTC----DFRHSRGRINV-GENIWAAPYSN-------------- 142

  Fly   152 LFEMAVQKWAGEEKDITAEDLKKTTPNP--------PEVIGHLTVLINEKSNAVGCGL-----VA 203
             :..|:..|..|            ..||        ....||...::..|:|.||||.     |.
 Worm   143 -YSDAISIWFNE------------VHNPRCGCNHAYKHCCGHYVQVVWAKTNLVGCGFSRCRDVQ 194

  Fly   204 YNLGEIRRYNLACNYAYTNVIGERVY 229
            ...|...|....|:|   |..|..|:
 Worm   195 GVWGRGHRNVFVCHY---NPQGNTVF 217

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42780NP_001284979.1 SCP_euk 62..219 CDD:240180 31/144 (22%)
lon-1NP_498166.1 SCP 81..211 CDD:214553 32/148 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.