DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42780 and GLIPR2

DIOPT Version :9

Sequence 1:NP_001284979.1 Gene:CG42780 / 10178796 FlyBaseID:FBgn0261848 Length:254 Species:Drosophila melanogaster
Sequence 2:NP_001273942.1 Gene:GLIPR2 / 152007 HGNCID:18007 Length:169 Species:Homo sapiens


Alignment Length:178 Identity:38/178 - (21%)
Similarity:67/178 - (37%) Gaps:50/178 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    63 NALIKAHNLVRQKWASGKAKIKWTACKMAKMEWNKDLEKLAILNAKTCLMGHD------ECHNTE 121
            |.::||||..|||......|:    ||    ..|::.::.:...|.|.::.|.      :|    
Human    26 NEVLKAHNEYRQKHGVPPLKL----CK----NLNREAQQYSEALASTRILKHSPESSRGQC---- 78

  Fly   122 KFRLSGQNLFAMGFSHARITKTKMNMTLSMLFEMAVQKWAGEEKDITAEDLKKTTPNPPEVIGHL 186
                 |:||     :.|...:|...:         ..:|..|.|:...:.     |......||.
Human    79 -----GENL-----AWASYDQTGKEV---------ADRWYSEIKNYNFQQ-----PGFTSGTGHF 119

  Fly   187 TVLINEKSNAVGCGLVAYNLGE---IRRYNLACNYAYTNVIGERVYEE 231
            |.::.:.:..:|.|..:.:.|.   :.||     :...||:.|..:||
Human   120 TAMVWKNTKKMGVGKASASDGSSFVVARY-----FPAGNVVNEGFFEE 162

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42780NP_001284979.1 SCP_euk 62..219 CDD:240180 33/164 (20%)
GLIPR2NP_001273942.1 SCP_GAPR-1_like 23..154 CDD:240182 33/168 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.