DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42780 and CG43777

DIOPT Version :9

Sequence 1:NP_001284979.1 Gene:CG42780 / 10178796 FlyBaseID:FBgn0261848 Length:254 Species:Drosophila melanogaster
Sequence 2:NP_001261163.1 Gene:CG43777 / 14462631 FlyBaseID:FBgn0264299 Length:273 Species:Drosophila melanogaster


Alignment Length:269 Identity:66/269 - (24%)
Similarity:114/269 - (42%) Gaps:48/269 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 VLSLVLHSLAENFC--RQDLCT-KGTTHIACQ----NVNGS---FGSSCPKDATVIKLNLGDKNA 64
            ||.|.|.| ..|:|  :...|. :...|..|.    .|.|:   |.:|.|.:..:.|:.|...|.
  Fly    10 VLLLPLTS-GYNYCNNKTHKCVLEKKKHFMCHLKDFTVYGNSTKFHASVPNNMRMQKIALDILNN 73

  Fly    65 LIKAHNLVRQKWASGKAKIKWT-----ACKMAKMEWNKDLEKLAILNAKTCLMGHDECHNTEKFR 124
            |       |.|:|.|:.:.|..     |.:|.::.|:|:|..:...:|.|..:...:|.:|.:|.
  Fly    74 L-------RNKFAGGELRTKGNKTFAKARRMRQLFWDKELAYMGNNHASTLSLKSSQCRSTLRFP 131

  Fly   125 LSGQNLFAMGFSHARIT-KTKMNMTLSMLFEMAVQKWAGEEKDITAED--LKKTTPNPPEVIGHL 186
            ..|:.:       |.:| :.|:|  |..::..|......|.:.::..|  |....|:....:.|.
  Fly   132 HVGEAI-------ALVTPREKLN--LKEIYSKAFTPMFAEYQHVSDPDALLHAFDPDRDFQVRHF 187

  Fly   187 TVLINEKSNAVGCGL-VAYNLGEIRRY--NLACNYAYTNVIGERVYE------ECAKAGIECAKG 242
            |.:|:::.:.||||: |..|.....::  .|.|.:.:.|:.|..||:      .|...|:..:  
  Fly   188 TNIISDRVSRVGCGVAVGANCNPSIKFCHFLTCYFDFHNMAGSYVYKAGDPTSSCDDWGVVSS-- 250

  Fly   243 IDQKYPPLC 251
              .||..||
  Fly   251 --DKYANLC 257

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42780NP_001284979.1 SCP_euk 62..219 CDD:240180 39/167 (23%)
CG43777NP_001261163.1 SCP_euk 64..223 CDD:240180 41/174 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45440684
Domainoid 1 1.000 41 1.000 Domainoid score I8510
eggNOG 1 0.900 - - E1_COG2340
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10334
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.850

Return to query results.
Submit another query.