DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42780 and GLIPR1L2

DIOPT Version :9

Sequence 1:NP_001284979.1 Gene:CG42780 / 10178796 FlyBaseID:FBgn0261848 Length:254 Species:Drosophila melanogaster
Sequence 2:NP_001257325.1 Gene:GLIPR1L2 / 144321 HGNCID:28592 Length:344 Species:Homo sapiens


Alignment Length:188 Identity:41/188 - (21%)
Similarity:68/188 - (36%) Gaps:40/188 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    63 NALIKAHNLVRQKWASGKAKIKWTACKMAKMEWNKDLEKLAILNAKTCLMGHD-------ECHNT 120
            |..:..||.:|.......:.:::       |.|:..|.:.|....|.||..|:       ..|  
Human    55 NEYVNLHNELRGDVIPRGSNLRF-------MTWDVALSRTARAWGKKCLFTHNIYLQDVQMVH-- 110

  Fly   121 EKFRLSGQNLFAMGFSHARITKTKMNMTLSMLFEMAVQKWAGEEKDITAEDLKKTTPNPPEVIGH 185
            .||...|:|::         ...:...|.|    :|::.|..|:|....|:...:..     ..:
Human   111 PKFYGIGENMW---------VGPENEFTAS----IAIRSWHAEKKMYNFENGSCSGD-----CSN 157

  Fly   186 LTVLINEKSNAVGCGLV-AYNLGEIRRYNL-ACNYAYTNVIGERVYEECAKAGIECAK 241
            ...|:.:.|..|||.:. ...:|.|....: .||||....:..|.||    .||.|.:
Human   158 YIQLVWDHSYKVGCAVTPCSKIGHIIHAAIFICNYAPGGTLTRRPYE----PGIFCTR 211

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42780NP_001284979.1 SCP_euk 62..219 CDD:240180 33/164 (20%)
GLIPR1L2NP_001257325.1 SCP_GLIPR-1_like 52..195 CDD:240185 35/166 (21%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 292..344
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165151328
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.750

Return to query results.
Submit another query.