DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42780 and glipr1a

DIOPT Version :9

Sequence 1:NP_001284979.1 Gene:CG42780 / 10178796 FlyBaseID:FBgn0261848 Length:254 Species:Drosophila melanogaster
Sequence 2:XP_017210734.1 Gene:glipr1a / 108179203 ZFINID:ZDB-GENE-110309-2 Length:269 Species:Danio rerio


Alignment Length:203 Identity:53/203 - (26%)
Similarity:76/203 - (37%) Gaps:45/203 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    66 IKAHNLVRQKWASGKAKIKWTACKMAKMEWNKDLEKLAILNAKTCLMGHD-------ECHNTEKF 123
            ::.||       ..::.:..||..|..|.|:..|...|...|:.||..|:       ..|.|  |
Zfish    36 VREHN-------QNRSSVSPTAANMRYMTWDAALAVTARAWARFCLFKHNIHLREAKRVHPT--F 91

  Fly   124 RLSGQNLFAMGFSHARITKTKMNMTLSMLFEMAVQKWAGEEKDITAEDLKKTTPNPPEVIGHLTV 188
            ...|:|::| |..::|.|           .:.||..|..|.||.   :......|..:|.||.|.
Zfish    92 TTVGENIWA-GAPYSRFT-----------VKSAVFSWVNELKDY---NYNNNQCNDKKVCGHYTQ 141

  Fly   189 LINEKSNAVGC-------GLVAYNLGEIRRYNLACNYAYT-NVIGERVYEECAKAGIECA--KGI 243
            ::...|..|||       |:...:...|:.....||||.. |..|...|    |.|..|:  .|.
Zfish   142 VVWADSYKVGCAVQTCPNGVAETHFSNIQGVIFVCNYATAGNFAGRSPY----KQGASCSGCGGS 202

  Fly   244 DQKYPPLC 251
            |:....||
Zfish   203 DKCERNLC 210

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42780NP_001284979.1 SCP_euk 62..219 CDD:240180 41/166 (25%)
glipr1aXP_017210734.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 76 1.000 Inparanoid score I5251
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.970

Return to query results.
Submit another query.