DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42780 and CRISP3

DIOPT Version :9

Sequence 1:NP_001284979.1 Gene:CG42780 / 10178796 FlyBaseID:FBgn0261848 Length:254 Species:Drosophila melanogaster
Sequence 2:NP_001355052.1 Gene:CRISP3 / 10321 HGNCID:16904 Length:276 Species:Homo sapiens


Alignment Length:261 Identity:59/261 - (22%)
Similarity:92/261 - (35%) Gaps:62/261 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 VLHSLAE-----NFCRQDLCTKGTTHIA----------CQNVNGSFGSSCPKD---ATVIKLNLG 60
            :||...|     |....|.|:.|....|          ...:..||.::..||   ..::.....
Human     4 ILHPALETTACTNHFNADPCSTGFVFPAMTLFPVLLFLVAGLLPSFPANEDKDPAFTALLTTQTQ 68

  Fly    61 DKNALIKAHNLVRQKWASGKAKIKWTACKMAKMEWNKDLEKLAILNAKTCLMGHDEC---HNTEK 122
            .:..::..||.:|:       .:...|..|.||||||:    |..||:...   ::|   |:..|
Human    69 VQREIVNKHNELRR-------AVSPPARNMLKMEWNKE----AAANAQKWA---NQCNYRHSNPK 119

  Fly   123 FRLS----GQNLFAMGFSHARITKTKMNMTLSMLFEMAVQKWAGEEKDITAEDLKKTTPNPPEVI 183
            .|::    |:||:....|.:              :..|:|.|..|..|.   |.......|..|:
Human   120 DRMTSLKCGENLYMSSASSS--------------WSQAIQSWFDEYNDF---DFGVGPKTPNAVV 167

  Fly   184 GHLTVLINEKSNAVGCGLVAYNLGEIRRYNLACNYAYTNVIGERVY------EECAKAGIECAKG 242
            ||.|.::...|..||||.......::.:|...|.|........|:|      ..||.....|..|
Human   168 GHYTQVVWYSSYLVGCGNAYCPNQKVLKYYYVCQYCPAGNWANRLYVPYEQGAPCASCPDNCDDG 232

  Fly   243 I 243
            :
Human   233 L 233

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42780NP_001284979.1 SCP_euk 62..219 CDD:240180 40/163 (25%)
CRISP3NP_001355052.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165151349
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.750

Return to query results.
Submit another query.