DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42780 and LOC101883528

DIOPT Version :9

Sequence 1:NP_001284979.1 Gene:CG42780 / 10178796 FlyBaseID:FBgn0261848 Length:254 Species:Drosophila melanogaster
Sequence 2:XP_005162473.1 Gene:LOC101883528 / 101883528 -ID:- Length:261 Species:Danio rerio


Alignment Length:206 Identity:50/206 - (24%)
Similarity:82/206 - (39%) Gaps:58/206 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    65 LIKAHNLVRQKWASGKAKIKWTACKMAKMEWNKDLEKLAILNAKTCLMGH--DECHNTEKFRLSG 127
            ::..||.:|       ::::.:|..|.|:.|::.:..:|...|..|:..|  |..|.|     .|
Zfish    31 IVDLHNELR-------SQVQPSAAFMQKVVWDETIRLVAEGYAAKCIWDHNPDLEHLT-----MG 83

  Fly   128 QNLFAMGFSHARITKTKMNMTLSMLFEMAVQKWAGEEKDIT------AEDLKKTTPNPPEVIGHL 186
            :||| :|......||             ||..|..|..|..      |||         ::.||.
Zfish    84 ENLF-VGTGPFNATK-------------AVMDWFNENLDYNYNTNDCAED---------KMCGHY 125

  Fly   187 TVLINEKSNAVGCGLVAYNLGEIRRYN------LACN-YAYTNVIGERVY---EECAKAGIECAK 241
            |.|:...:..:||  .:|....:.:.:      |.|: |...|:.|::.|   |.|:|...||..
Zfish   126 TQLVWANTTKIGC--ASYFCDTLEKLHFEKATLLICDYYPQGNIEGQKPYESGESCSKCPEECEN 188

  Fly   242 GI---DQKYPP 249
            .|   :..:||
Zfish   189 NICVMENLFPP 199

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42780NP_001284979.1 SCP_euk 62..219 CDD:240180 38/168 (23%)
LOC101883528XP_005162473.1 SCP_HrTT-1 28..162 CDD:240186 38/167 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.