DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42780 and LOC100536500

DIOPT Version :9

Sequence 1:NP_001284979.1 Gene:CG42780 / 10178796 FlyBaseID:FBgn0261848 Length:254 Species:Drosophila melanogaster
Sequence 2:XP_017207056.1 Gene:LOC100536500 / 100536500 -ID:- Length:245 Species:Danio rerio


Alignment Length:280 Identity:57/280 - (20%)
Similarity:85/280 - (30%) Gaps:102/280 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 LCTKGTTHI--ACQNVNGSFGSSCPKDATVIKLNLGDKNALIKAHNLVRQKWASGKAKIKWTACK 89
            :|..|..|:  || :|.|    .|.:.::|       :..::..||..|:       .::.:|..
Zfish    15 ICFLGFLHMSAAC-SVTG----VCTELSSV-------QQEIVDVHNAFRR-------AVQPSASN 60

  Fly    90 MAKMEWNKDLEKLAILNAKTCLMGHDECHNTEKFRL-----SGQNLF-AMGFSHARITKTKMNMT 148
            |.||.|:..:.:.|......|.|    .|.....|:     .|:||| |.|.|.           
Zfish    61 MLKMSWSDAVAESARGWINKCNM----THGPPSSRMLNGYEMGENLFKATGISS----------- 110

  Fly   149 LSMLFEMAVQKWAGEEKD-------ITAEDLKKTTPNPPEVIGHLTVLINEKSNAVGC------- 199
                :...|..|..|..:       |..           :..||.|.::...|..|||       
Zfish   111 ----WTSVVDAWHSEVNNYKYPIGSING-----------QATGHYTQVVWYSSYEVGCAVTQCGS 160

  Fly   200 ----GLVAYNLGEIRR---YNL------------------ACNY--AYTNVIGERVYEEC----A 233
                |...|..|..|.   |:|                  ||.|  .:.|....:....|    .
Zfish   161 NYFYGCHYYRAGNFRTVPPYSLGSPCASCPNNCEDNLCTNACPYINGFVNCDALKAKLTCENTAV 225

  Fly   234 KAGIECAKGIDQKYPPLCAK 253
            |.|...:...|.|..|:..|
Zfish   226 KLGCPASCLCDNKIIPIAKK 245

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42780NP_001284979.1 SCP_euk 62..219 CDD:240180 40/203 (20%)
LOC100536500XP_017207056.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170585635
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 76 1.000 Inparanoid score I5251
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.900

Return to query results.
Submit another query.