DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42780 and r3hdml

DIOPT Version :9

Sequence 1:NP_001284979.1 Gene:CG42780 / 10178796 FlyBaseID:FBgn0261848 Length:254 Species:Drosophila melanogaster
Sequence 2:XP_017953344.1 Gene:r3hdml / 100492715 XenbaseID:XB-GENE-1011048 Length:253 Species:Xenopus tropicalis


Alignment Length:241 Identity:61/241 - (25%)
Similarity:97/241 - (40%) Gaps:43/241 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 LCTKGTTHIACQNVNGS---FGSSCPKDATVIKLNLGDKNALIKAHNLVRQKWASGKAKIKWTAC 88
            |..:.|..::..|.|.:   |||..|:......::..|.:||:..||.||       :|:...|.
 Frog    25 LLDRATELLSLSNRNQTEHMFGSGIPRIRRKRYISPRDMSALLDYHNQVR-------SKVFPPAA 82

  Fly    89 KMAKMEWNKDLEKLAILNAKTCLMGHDECHNTEKFRLSGQNLFAMGFSHARITKTKMNMTLSMLF 153
            .|..|.|::.|.|.|...|..|...|..   .:..|..||||..    |:...::.:::      
 Frog    83 NMEYMVWDERLAKSAESWANQCKWDHGP---NQLMRYIGQNLSV----HSGRYRSIVDL------ 134

  Fly   154 EMAVQKWAGEEKDITAEDLKKTTPNPPE-----VIGHLTVLINEKSNAVGCGL-VAYNL---GEI 209
               |:.|..|.:..:....::..|:.|.     |..|.|.::...||.:||.: :..|:   |..
 Frog   135 ---VKGWYDERQHYSFPHPRECNPSCPNKCTGAVCTHYTQMVWASSNRIGCAVNICTNINVWGST 196

  Fly   210 RRY--NLACNYAYT-NVIGERVYEECAKAGIECAKGIDQKYPPLCA 252
            .|.  .|.|||:.. |.|||..|    |.|..|: .....|..:|:
 Frog   197 WRQASYLVCNYSIKGNWIGEAPY----KLGRPCS-ACPPSYGGVCS 237

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42780NP_001284979.1 SCP_euk 62..219 CDD:240180 41/167 (25%)
r3hdmlXP_017953344.1 CAP_R3HDML 63..208 CDD:349409 41/167 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 69 1.000 Inparanoid score I5157
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10334
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.160

Return to query results.
Submit another query.