DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42780 and crispld1

DIOPT Version :9

Sequence 1:NP_001284979.1 Gene:CG42780 / 10178796 FlyBaseID:FBgn0261848 Length:254 Species:Drosophila melanogaster
Sequence 2:XP_002937123.2 Gene:crispld1 / 100490431 XenbaseID:XB-GENE-989389 Length:514 Species:Xenopus tropicalis


Alignment Length:217 Identity:54/217 - (24%)
Similarity:80/217 - (36%) Gaps:56/217 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    61 DKNALIKAHNLVRQKWASGKAKIKWTACKMAKMEWNKDLEKLAILNAKTCLMGHDECHNTEKFRL 125
            |...::..||.:|       .::...|..|..|.|:.:||:.|...|:|||..|..   .:...:
 Frog    61 DMKLILDLHNKLR-------GEVYPPASNMEFMIWDVELERSAEAWAETCLWEHGP---ADLLPV 115

  Fly   126 SGQNLFAMGFSHARITKTKMNMTLSMLFEMAVQKWAGEEKDITAEDLKKTTPNPP-----EVIGH 185
            .||||   |....|......:          ||.|..|.:|.|....::..|..|     .|..|
 Frog   116 IGQNL---GAHWGRYRPPTYH----------VQAWYDEVRDYTFPYPQECDPYCPFRCSGPVCTH 167

  Fly   186 LTVLINEKSNAVGCGL-VAYNL---GEI--RRYNLACNYA-YTNVIGERVYEECAKAGIECA--- 240
            .|.|:...|:.:||.: :.:|:   |:|  :...|.|||: ..|..|...|    |.|..|:   
 Frog   168 YTQLVWATSSRIGCAINLCHNMNVWGQIWPKAIYLVCNYSPKGNWWGHAPY----KHGHPCSACP 228

  Fly   241 --------------KGIDQKYP 248
                          .|.|..||
 Frog   229 PSYGGGCKDNLCYKDGSDLHYP 250

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42780NP_001284979.1 SCP_euk 62..219 CDD:240180 42/167 (25%)
crispld1XP_002937123.2 CAP_CRISPLD1 62..207 CDD:349407 42/167 (25%)
LCCL 304..388 CDD:128866
LCCL 407..506 CDD:367672
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10334
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.020

Return to query results.
Submit another query.