DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42780 and LOC100490275

DIOPT Version :9

Sequence 1:NP_001284979.1 Gene:CG42780 / 10178796 FlyBaseID:FBgn0261848 Length:254 Species:Drosophila melanogaster
Sequence 2:XP_031754789.1 Gene:LOC100490275 / 100490275 -ID:- Length:291 Species:Xenopus tropicalis


Alignment Length:185 Identity:53/185 - (28%)
Similarity:82/185 - (44%) Gaps:41/185 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    65 LIKAHNLVRQKWASGKAKIKWTACKMAKMEWNKDLEKLA---ILNAKTCLMGHDECHNTE----K 122
            |:.|||.:|.::  ||     .|..|..|.|:..|.|||   .:|.|.....|   .|.|    :
 Frog    33 LVNAHNDIRNEF--GK-----QAANMLHMSWDVGLAKLAQAWTINCKKVPNPH---LNKESIYPR 87

  Fly   123 FRLSGQNLFAMGFSHARITKTKMNMTLSMLFEMAVQKWAGEEKDITAEDLKKTTPNPPEVIGHLT 187
            |:..|:||: ||.|             ..:|:: |..| |.|.:.  .|||..:..|.:...|.|
 Frog    88 FKQIGENLY-MGPS-------------IDIFKI-VTNW-GLEGNF--YDLKNNSCQPGKDCSHFT 134

  Fly   188 VLINEKSNAVGCGLVAYNLGEIRRYNLACNYA-YTNVIGERVY---EECAKAGIE 238
            .::...:..|||| .||...:: .|.::|.|. ..|::|:..:   .:|:|.|.|
 Frog   135 QIVWANTYKVGCG-AAYCAHKV-AYVVSCTYGPRGNLLGQVPFILGVKCSKCGGE 187

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42780NP_001284979.1 SCP_euk 62..219 CDD:240180 46/160 (29%)
LOC100490275XP_031754789.1 CAP 28..167 CDD:412178 47/163 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 69 1.000 Inparanoid score I5157
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.060

Return to query results.
Submit another query.