DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42716 and CG42464

DIOPT Version :10

Sequence 1:NP_001189116.1 Gene:CG42716 / 10178784 FlyBaseID:FBgn0261633 Length:97 Species:Drosophila melanogaster
Sequence 2:NP_001162863.1 Gene:CG42464 / 8674117 FlyBaseID:FBgn0259954 Length:87 Species:Drosophila melanogaster


Alignment Length:50 Identity:19/50 - (38%)
Similarity:26/50 - (52%) Gaps:4/50 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    45 FG--LGCAMNFMPLVWYYNDKSRRCETMPYLGCGGNSNRFCSLQDCRFTC 92
            ||  :.|| ::.....|::||: .|....|.|||||.|||.:...|...|
  Fly    33 FGKIMSCA-HYSNWFSYHSDKN-ECLEFSYGGCGGNENRFQTKAICEDLC 80

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42716NP_001189116.1 Kunitz-type <58..92 CDD:438633 14/33 (42%)
CG42464NP_001162863.1 Kunitz_SCI-I-like 23..80 CDD:438677 18/48 (38%)

Return to query results.
Submit another query.