DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42716 and CG42538

DIOPT Version :9

Sequence 1:NP_001189116.1 Gene:CG42716 / 10178784 FlyBaseID:FBgn0261633 Length:97 Species:Drosophila melanogaster
Sequence 2:NP_001163451.1 Gene:CG42538 / 8673985 FlyBaseID:FBgn0260646 Length:89 Species:Drosophila melanogaster


Alignment Length:90 Identity:39/90 - (43%)
Similarity:55/90 - (61%) Gaps:8/90 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MNFLIILAFFTLNMAFANSQLRCRARMNSGGP--RSCSGSRNIGTAFGLGCAMNFMPLVWYYNDK 63
            |.||:|:|..||.:|..|:|: |:.|     |  :.|:|.|:.|...|..|.:.....:|:||.:
  Fly     1 MKFLLIMACLTLYVASINAQI-CQGR-----PVFQLCTGGRDEGNRNGRFCGLTAQNGMWFYNSR 59

  Fly    64 SRRCETMPYLGCGGNSNRFCSLQDC 88
            |||||.|.|.|||||.||:|.::||
  Fly    60 SRRCEKMNYRGCGGNGNRYCKVEDC 84

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42716NP_001189116.1 KU <58..92 CDD:197529 20/31 (65%)
CG42538NP_001163451.1 KU <53..88 CDD:294074 20/32 (63%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45470120
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0012709
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.740

Return to query results.
Submit another query.