DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42716 and PRY3

DIOPT Version :9

Sequence 1:NP_001189116.1 Gene:CG42716 / 10178784 FlyBaseID:FBgn0261633 Length:97 Species:Drosophila melanogaster
Sequence 2:NP_012457.1 Gene:PRY3 / 853367 SGDID:S000003614 Length:881 Species:Saccharomyces cerevisiae


Alignment Length:32 Identity:7/32 - (21%)
Similarity:14/32 - (43%) Gaps:12/32 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly    52 NFMPLVWYYNDKSRRCETMPYLGCGGNSNRFC 83
            :|..:||         ::...:|||   .::|
Yeast   113 HFTQVVW---------KSTAEIGCG---YKYC 132

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42716NP_001189116.1 KU <58..92 CDD:197529 5/26 (19%)
PRY3NP_012457.1 CAP_PRY1-like 24..152 CDD:349403 7/32 (22%)
ser_rich_anae_1 <598..>855 CDD:411418
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.