powered by:
Protein Alignment CG42716 and PRY1
DIOPT Version :9
Sequence 1: | NP_001189116.1 |
Gene: | CG42716 / 10178784 |
FlyBaseID: | FBgn0261633 |
Length: | 97 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_012456.1 |
Gene: | PRY1 / 853366 |
SGDID: | S000003615 |
Length: | 299 |
Species: | Saccharomyces cerevisiae |
Alignment Length: | 70 |
Identity: | 15/70 - (21%) |
Similarity: | 27/70 - (38%) |
Gaps: | 18/70 - (25%) |
- Green bases have known domain annotations that are detailed below.
Fly 35 CSGS-RNIGTAFGLGCAMNF---MPLVWYYNDKSRRCETMPYLGCGGNSNRF------------C 83
|||: .:.|..:|...|:.: ..:..:||:.|....:.| |...|:..| |
Yeast 202 CSGTLTHSGGPYGENLALGYDGPAAVDAWYNEISNYDFSNP--GFSSNTGHFTQVVWKSTTQVGC 264
Fly 84 SLQDC 88
.::.|
Yeast 265 GIKTC 269
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_COG2340 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.900 |
|
Return to query results.
Submit another query.