DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42716 and TFPI2

DIOPT Version :10

Sequence 1:NP_001189116.1 Gene:CG42716 / 10178784 FlyBaseID:FBgn0261633 Length:97 Species:Drosophila melanogaster
Sequence 2:NP_006519.1 Gene:TFPI2 / 7980 HGNCID:11761 Length:235 Species:Homo sapiens


Alignment Length:106 Identity:31/106 - (29%)
Similarity:42/106 - (39%) Gaps:33/106 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 FFTLNMAFANSQLRCRARMNSGGPRSCSGSR------NIGTAFGLGCAMNFMPLV---------- 57
            ||.|      |.:.|. :..|||   |..:|      :..|..|. ||...:|..          
Human   114 FFNL------SSMTCE-KFFSGG---CHRNRIENRFPDEATCMGF-CAPKKIPSFCYSPKDEGLC 167

  Fly    58 ------WYYNDKSRRCETMPYLGCGGNSNRFCSLQDCRFTC 92
                  :|:|.:.|.|:...|.|||||.|.|.|.:||:..|
Human   168 SANVTRYYFNPRYRTCDAFTYTGCGGNDNNFVSREDCKRAC 208

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42716NP_001189116.1 Kunitz-type <58..92 CDD:438633 15/33 (45%)
TFPI2NP_006519.1 Kunitz_TFPI2_1-like 32..88 CDD:438659
Kunitz_BPTI 95..149 CDD:425421 12/45 (27%)
Kunitz_TFPI1_TFPI2_3-like 155..204 CDD:438658 14/48 (29%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.