DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42716 and CRISP2

DIOPT Version :9

Sequence 1:NP_001189116.1 Gene:CG42716 / 10178784 FlyBaseID:FBgn0261633 Length:97 Species:Drosophila melanogaster
Sequence 2:XP_005249406.1 Gene:CRISP2 / 7180 HGNCID:12024 Length:278 Species:Homo sapiens


Alignment Length:36 Identity:10/36 - (27%)
Similarity:15/36 - (41%) Gaps:12/36 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    52 NFMPLVWYYNDKSRRCETMPYLGCGGNSNRFCSLQD 87
            ::..||||         :...:|||   ..:|..||
Human   136 HYTQLVWY---------STYQVGCG---IAYCPNQD 159

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42716NP_001189116.1 KU <58..92 CDD:197529 8/30 (27%)
CRISP2XP_005249406.1 SCP_CRISP 35..172 CDD:240183 10/36 (28%)
Crisp 224..278 CDD:285731
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.