DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42716 and Eppin

DIOPT Version :10

Sequence 1:NP_001189116.1 Gene:CG42716 / 10178784 FlyBaseID:FBgn0261633 Length:97 Species:Drosophila melanogaster
Sequence 2:NP_001102927.1 Gene:Eppin / 685161 RGDID:1597722 Length:134 Species:Rattus norvegicus


Alignment Length:45 Identity:18/45 - (40%)
Similarity:24/45 - (53%) Gaps:1/45 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    48 GCAMNFMPLVWYYNDKSRRCETMPYLGCGGNSNRFCSLQDCRFTC 92
            |..|.:.|. |:||.|:..|:...|.||.||:|.|.|...|:..|
  Rat    84 GYCMAYFPR-WWYNKKNGTCQLFIYGGCQGNNNNFQSQSICQNAC 127

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42716NP_001189116.1 Kunitz-type <58..92 CDD:438633 14/33 (42%)
EppinNP_001102927.1 WAP 30..72 CDD:459672
Kunitz_eppin 75..131 CDD:438654 18/45 (40%)
Interaction with SEMG1. /evidence=ECO:0000250 102..133 11/26 (42%)
Interaction with LTF. /evidence=ECO:0000250 117..133 4/11 (36%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.