DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42716 and Wfdc6a

DIOPT Version :10

Sequence 1:NP_001189116.1 Gene:CG42716 / 10178784 FlyBaseID:FBgn0261633 Length:97 Species:Drosophila melanogaster
Sequence 2:NP_001233212.2 Gene:Wfdc6a / 685153 RGDID:1597730 Length:146 Species:Rattus norvegicus


Alignment Length:45 Identity:16/45 - (35%)
Similarity:22/45 - (48%) Gaps:1/45 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    48 GCAMNFMPLVWYYNDKSRRCETMPYLGCGGNSNRFCSLQDCRFTC 92
            |..:.::|. |:||:.:..|....|.||.||.|.|.|...|...|
  Rat    94 GPCLAYLPR-WWYNEDTGLCTQFIYGGCQGNPNNFQSEGICTVVC 137

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42716NP_001189116.1 Kunitz-type <58..92 CDD:438633 13/33 (39%)
Wfdc6aNP_001233212.2 WAP 42..81 CDD:459672
Kunitz_eppin 85..141 CDD:438654 16/45 (36%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.