DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42716 and wfikkn2b

DIOPT Version :10

Sequence 1:NP_001189116.1 Gene:CG42716 / 10178784 FlyBaseID:FBgn0261633 Length:97 Species:Drosophila melanogaster
Sequence 2:XP_699239.1 Gene:wfikkn2b / 570642 ZFINID:ZDB-GENE-110414-1 Length:563 Species:Danio rerio


Alignment Length:38 Identity:12/38 - (31%)
Similarity:18/38 - (47%) Gaps:0/38 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    56 LVWYYNDKSRRCETMPYLGCGGNSNRFCSLQDCRFTCL 93
            |.|:::.:...|.|..|..|..|.|.|...:.|..:||
Zfish   331 LSWFFDPQRNSCNTFTYRNCSSNRNHFDDYESCMSSCL 368

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42716NP_001189116.1 Kunitz-type <58..92 CDD:438633 9/33 (27%)
wfikkn2bXP_699239.1 WAP 39..88 CDD:459672
KAZAL_FS 135..171 CDD:238052
Ig 207..298 CDD:472250
Ig strand B 224..228 CDD:409353
Ig strand C 237..241 CDD:409353
Ig strand E 256..260 CDD:409353
Ig strand F 278..283 CDD:409353
Ig strand G 291..294 CDD:409353
Kunitz_WFIKKN_1-like 316..367 CDD:438648 10/35 (29%)
Kunitz_WFIKKN_2-like 374..426 CDD:438649
NTR_like 443..551 CDD:470599
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.