powered by:
Protein Alignment CG42716 and r3hdml
DIOPT Version :9
Sequence 1: | NP_001189116.1 |
Gene: | CG42716 / 10178784 |
FlyBaseID: | FBgn0261633 |
Length: | 97 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001373427.1 |
Gene: | r3hdml / 561976 |
ZFINID: | ZDB-GENE-090313-275 |
Length: | 252 |
Species: | Danio rerio |
Alignment Length: | 44 |
Identity: | 10/44 - (22%) |
Similarity: | 16/44 - (36%) |
Gaps: | 19/44 - (43%) |
- Green bases have known domain annotations that are detailed below.
Fly 32 PRSCSGSRNIGTAFGLGCAMNFMPLVWYYNDKSRRCETMPYLGC 75
|..|||| ...::..:||..::| :||
Zfish 151 PSRCSGS----------VCTHYTQMVWAASNK---------IGC 175
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
CG42716 | NP_001189116.1 |
KU |
<58..92 |
CDD:197529 |
4/18 (22%) |
r3hdml | NP_001373427.1 |
CAP_R3HDML |
66..201 |
CDD:349409 |
10/44 (23%) |
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_COG2340 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
ZFIN |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.900 |
|
Return to query results.
Submit another query.