powered by:
Protein Alignment CG42716 and Wfdc6b
DIOPT Version :9
Sequence 1: | NP_001189116.1 |
Gene: | CG42716 / 10178784 |
FlyBaseID: | FBgn0261633 |
Length: | 97 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001008867.1 |
Gene: | Wfdc6b / 408225 |
RGDID: | 1303277 |
Length: | 182 |
Species: | Rattus norvegicus |
Alignment Length: | 45 |
Identity: | 17/45 - (37%) |
Similarity: | 23/45 - (51%) |
Gaps: | 1/45 - (2%) |
- Green bases have known domain annotations that are detailed below.
Fly 48 GCAMNFMPLVWYYNDKSRRCETMPYLGCGGNSNRFCSLQDCRFTC 92
|..:.::|. |:||.|:..|....|.||.||:|.|.|...|...|
Rat 84 GPCLAYLPR-WWYNKKTNLCTQFIYGGCQGNTNNFLSKDICTSIC 127
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
CG42716 | NP_001189116.1 |
KU |
<58..92 |
CDD:197529 |
14/33 (42%) |
Wfdc6b | NP_001008867.1 |
WAP |
32..71 |
CDD:278522 |
|
Kunitz_BPTI |
76..127 |
CDD:278443 |
16/43 (37%) |
Blue background indicates that the domain is not in
the aligned region.
|
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.910 |
|
Return to query results.
Submit another query.