powered by:
Protein Alignment CG42716 and CG6628
DIOPT Version :9
Sequence 1: | NP_001189116.1 |
Gene: | CG42716 / 10178784 |
FlyBaseID: | FBgn0261633 |
Length: | 97 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_648386.1 |
Gene: | CG6628 / 39183 |
FlyBaseID: | FBgn0036072 |
Length: | 277 |
Species: | Drosophila melanogaster |
Alignment Length: | 47 |
Identity: | 13/47 - (27%) |
Similarity: | 23/47 - (48%) |
Gaps: | 11/47 - (23%) |
- Green bases have known domain annotations that are detailed below.
Fly 45 FGLGC--AMNFMPLVWYYNDKSRRCETMPYLGCGGNSNRFCSLQDCR 89
|.|.| |.|::|....|.:|:..|:: |:..::.|| |:
Fly 218 FLLACNYASNYVPDWPIYKEKAIGCQS-------GSDLKYPSL--CK 255
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
CG42716 | NP_001189116.1 |
KU |
<58..92 |
CDD:197529 |
7/32 (22%) |
CG6628 | NP_648386.1 |
SCP_euk |
69..225 |
CDD:240180 |
3/6 (50%) |
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_COG2340 |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.900 |
|
Return to query results.
Submit another query.