DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42716 and tfpil

DIOPT Version :10

Sequence 1:NP_001189116.1 Gene:CG42716 / 10178784 FlyBaseID:FBgn0261633 Length:97 Species:Drosophila melanogaster
Sequence 2:NP_001373281.1 Gene:tfpil / 322379 ZFINID:ZDB-GENE-030131-1098 Length:211 Species:Danio rerio


Alignment Length:59 Identity:24/59 - (40%)
Similarity:33/59 - (55%) Gaps:7/59 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 CSGSRNIGTAFGLGCAMNFMPLVWYYNDKSRRCETMPYLGCGGNSNRFCSLQDCRFTCL 93
            ||...:.||.|.|      .|: :|||.:.:.|....|.||.||:|||.|.::|:.|||
Zfish    93 CSMEMDEGTCFAL------FPM-YYYNAEEKICRMFIYRGCRGNANRFESREECQQTCL 144

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42716NP_001189116.1 Kunitz-type <58..92 CDD:438633 14/33 (42%)
tfpilNP_001373281.1 Kunitz_conkunitzin 27..77 CDD:438636
Kunitz-type 93..143 CDD:438633 21/56 (38%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.