powered by:
Protein Alignment CG42716 and wu:fb59d01
DIOPT Version :9
Sequence 1: | NP_001189116.1 |
Gene: | CG42716 / 10178784 |
FlyBaseID: | FBgn0261633 |
Length: | 97 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001373281.1 |
Gene: | wu:fb59d01 / 322379 |
ZFINID: | ZDB-GENE-030131-1098 |
Length: | 211 |
Species: | Danio rerio |
Alignment Length: | 59 |
Identity: | 24/59 - (40%) |
Similarity: | 33/59 - (55%) |
Gaps: | 7/59 - (11%) |
- Green bases have known domain annotations that are detailed below.
Fly 35 CSGSRNIGTAFGLGCAMNFMPLVWYYNDKSRRCETMPYLGCGGNSNRFCSLQDCRFTCL 93
||...:.||.|.| .|: :|||.:.:.|....|.||.||:|||.|.::|:.|||
Zfish 93 CSMEMDEGTCFAL------FPM-YYYNAEEKICRMFIYRGCRGNANRFESREECQQTCL 144
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
CG42716 | NP_001189116.1 |
KU |
<58..92 |
CDD:197529 |
14/33 (42%) |
wu:fb59d01 | NP_001373281.1 |
Kunitz_BPTI |
27..77 |
CDD:394972 |
|
Kunitz_BPTI |
92..143 |
CDD:394972 |
21/56 (38%) |
Blue background indicates that the domain is not in
the aligned region.
|
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
ZFIN |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.910 |
|
Return to query results.
Submit another query.