DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42716 and Tfpi

DIOPT Version :10

Sequence 1:NP_001189116.1 Gene:CG42716 / 10178784 FlyBaseID:FBgn0261633 Length:97 Species:Drosophila melanogaster
Sequence 2:XP_008760202.1 Gene:Tfpi / 29436 RGDID:61914 Length:306 Species:Rattus norvegicus


Alignment Length:117 Identity:34/117 - (29%)
Similarity:46/117 - (39%) Gaps:51/117 - (43%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 CRA-------RMNS--------GGPRSCSGSRN--------------------IGTAFGL----- 47
            |:|       .|||        ||   |.|::|                    |.|..|.     
  Rat    62 CKAMIRSYYFNMNSHQCEEFIYGG---CRGNKNRFDTLEECRKTCIPGYKKTTIKTTSGAEKPDF 123

  Fly    48 -------GCAMNFMPLVWYYNDKSRRCETMPYLGCGGNSNRFCSLQDCRFTC 92
                   |....||.. ::||::|::||...|.||.||||.|.:|::||.||
  Rat   124 CFLEEDPGICRGFMTR-YFYNNQSKQCEQFKYGGCLGNSNNFETLEECRNTC 174

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42716NP_001189116.1 Kunitz-type <58..92 CDD:438633 16/33 (48%)
TfpiXP_008760202.1 Kunitz_TFPI1_1-like 50..104 CDD:438656 10/44 (23%)
Kunitz_TFPI1_2-like 120..175 CDD:438657 21/56 (38%)
Kunitz_TFPI1_TFPI2_3-like 223..276 CDD:438658
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.