DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42716 and scl-9

DIOPT Version :9

Sequence 1:NP_001189116.1 Gene:CG42716 / 10178784 FlyBaseID:FBgn0261633 Length:97 Species:Drosophila melanogaster
Sequence 2:NP_502497.1 Gene:scl-9 / 186048 WormBaseID:WBGene00009890 Length:213 Species:Caenorhabditis elegans


Alignment Length:153 Identity:27/153 - (17%)
Similarity:43/153 - (28%) Gaps:59/153 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MNFLIILAFFTLNMAFANSQLRCRARMNSGGPRSCSGSR---NIGTAFGLGCAMN---------- 52
            :|.|.:...|...:|......|...:.::...|..|.|:   |..|.|...|..|          
 Worm    26 LNLLNVHNEFRSQLALGQLSFRGVKKPSASMMRKISWSKKLTNAATKFAETCPKNHSVVMNTGES 90

  Fly    53 -----------------FMPLVWY------------YNDKSRRCE----------TMPYLGCGGN 78
                             ..|..|:            ||..|:|.:          |...:|||.:
 Worm    91 IFWHFSSSLSTPEQYATLAPQKWWNEFETNGWDSLIYNHASQRFQIGHAVQMAWHTTSKVGCGYS 155

  Fly    79 SNRFCSL----QDCRFTCLQFKR 97
            .   |::    |.....|..|::
 Worm   156 K---CAVGTPEQTMVVVCRYFQK 175

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42716NP_001189116.1 KU <58..92 CDD:197529 11/59 (19%)
scl-9NP_502497.1 SCP 23..174 CDD:214553 26/150 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.