DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42716 and CG42828

DIOPT Version :9

Sequence 1:NP_001189116.1 Gene:CG42716 / 10178784 FlyBaseID:FBgn0261633 Length:97 Species:Drosophila melanogaster
Sequence 2:NP_001189271.1 Gene:CG42828 / 10178934 FlyBaseID:FBgn0262010 Length:89 Species:Drosophila melanogaster


Alignment Length:91 Identity:22/91 - (24%)
Similarity:35/91 - (38%) Gaps:20/91 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 FLIILAFFTLNMAFANSQLR-CRARMNSGGPRSCSGSRNIGTAFGLGCAMNFMPLVWYYNDKSRR 66
            ||.:||.....:..|..:.. |......|   .|.|.|                ::|.:::|.:.
  Fly     7 FLCLLAVLLSTVESAEKRKAFCYLPYEFG---KCGGHR----------------IMWAFSNKEQE 52

  Fly    67 CETMPYLGCGGNSNRFCSLQDCRFTC 92
            |....:..||||.|||.:.::|...|
  Fly    53 CVPFVFSNCGGNENRFYTKENCEKAC 78

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42716NP_001189116.1 KU <58..92 CDD:197529 11/33 (33%)
CG42828NP_001189271.1 KU 27..78 CDD:197529 16/69 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.